PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00394.1_g00021.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CO-like
Protein Properties Length: 358aa    MW: 39579.4 Da    PI: 5.0492
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00394.1_g00021.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.91.6e-06444539
                 zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                             +C+ ++e++   +C++++ +lC +C  + H+       H++
  Rsa1.0_00394.1_g00021.1  4 MCDFCGEQRSMVYCRSDSACLCLSCDRSVHSAnalskrHSR 44
                             6*****************************65677777765 PP

2zf-B_box223.4e-074694441
                 zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg...........Htvvp 41
                              +C++++ ++++  C + ++ lC++C  ++H++           H++++
  Rsa1.0_00394.1_g00021.1 46 LVCERCNAQPANVRCVEERVSLCQNCDWSGHNNnnnnnnsssndHKRQT 94
                             68*****************************888888888888888765 PP

3CCT60.45.8e-21301344144
                      CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                              R++a++RYkeK+k RkF+K++rY+sRKa+A+ R RvKGrFvk+ 
  Rsa1.0_00394.1_g00021.1 301 RNNAVMRYKEKKKARKFDKRVRYASRKARADVRRRVKGRFVKAG 344
                              99***************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.897147IPR000315B-box-type zinc finger
SMARTSM003364.9E-9447IPR000315B-box-type zinc finger
CDDcd000211.08E-7447No hitNo description
PROSITE profilePS501199.1864395IPR000315B-box-type zinc finger
CDDcd000213.41E-54776No hitNo description
SMARTSM003360.954895IPR000315B-box-type zinc finger
PfamPF062039.7E-16301343IPR010402CCT domain
PROSITE profilePS5101715.338301343IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MGYMCDFCGE QRSMVYCRSD SACLCLSCDR SVHSANALSK RHSRTLVCER CNAQPANVRC  60
VEERVSLCQN CDWSGHNNNN NNNNSSSNDH KRQTISCYSG CPSSSELASI WSFCSDLPGE  120
SACEQEMGMM NIDDDDEDKK DVAVGSSSKP DENSSCYGLK DVEVCEDDFY GNLGMDEVDL  180
ALENYEELFG TAFNASGQLF GQGGIDSLFQ KHHQAAAAAP ERGSTVQPDE SNDSFMSSKT  240
EPIICYTSKN ISFSGVTGES SAGDFQECGA SSSVQLLGEP PWYPQTSSQD NNNACSHSVT  300
RNNAVMRYKE KKKARKFDKR VRYASRKARA DVRRRVKGRF VKAGEAYDYD PLTPTRSY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006407811.10.0hypothetical protein EUTSA_v10020967mg
RefseqXP_006407812.10.0hypothetical protein EUTSA_v10020967mg
SwissprotQ9SSE50.0COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLV4LFJ10.0V4LFJ1_EUTSA; Uncharacterized protein
STRINGBra001264.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16822786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.41e-177CONSTANS-like 9